Recombinant Human Pulmonary surfactant-associated protein B (SFTPB), Unconjugated

Produktübersicht

• Artikelname: Recombinant Human Pulmonary surfactant-associated protein B (SFTPB), Unconjugated
• Artikelnummer: BIM-RPC24945
• Hersteller Artikelnummer: RPC24945
• Alternativnummer: BIM-RPC24945-20UG, BIM-RPC24945-100UG, BIM-RPC24945-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: 18 kDa pulmonary-surfactant protein6 kDa proteinPulmonary surfactant-associated proteolipid SPL(Phe)

Produktbeschreibung

Recombinant Human Pulmonary surfactant-associated protein B (SFTPB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: SFTPB. Target Synonyms: 1

Produkteigenschaften

• Molekulargewicht: 8.7kDa
• Tag: Tag-Free
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM
• Target-Kategorie: SFTPB