Recombinant Mouse Osteopontin (Spp1), partial, Unconjugated

Produktübersicht

• Artikelname: Recombinant Mouse Osteopontin (Spp1), partial, Unconjugated
• Artikelnummer: BIM-RPC24965
• Hersteller Artikelnummer: RPC24965
• Alternativnummer: BIM-RPC24965-20UG, BIM-RPC24965-100UG, BIM-RPC24965-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Mouse
• Konjugation: Unconjugated
• Alternative Synonym: 2ARBone sialoprotein 1Calcium oxalate crystal growth inhibitor protein, Early T-lymphocyte activation 1 protein, Minopontin, Secreted phosphoprotein 1, SPP-1

Produktbeschreibung

Recombinant Mouse Osteopontin (Spp1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Spp1. Target Synonyms: 2ARBone sialoprotein 1Ca

Produkteigenschaften

• Molekulargewicht: 32.3kDa
• Tag: N-Terminal 6Xhis-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: LPVKVTDSGSSEEKLYSLHPDPIATWLVPDPSQKQNLLAPQNAVSSEEKDDFKQETLPSNSNESHDHMDDDDDDDDDDGDHAESEDSVDSDESDESHHSDESDETVTASTQADTFTPIVPTVDVPNGRGDSLAYGLRSKSRSFQVSDEQYPDATDEDLTSHMKSGESKESLDVIPVAQLLSMPSDQDNNGKGSHESSQLDEPSLETHRLEHSKESQESADQSDVIDSQASSKASLEHQSHKFHSHKDKLVLDPK
• Target-Kategorie: Spp1