Recombinant Mouse Thrombospondin-2 (Thbs2), partial, Unconjugated

Artikelnummer: BIM-RPC24988
Artikelname: Recombinant Mouse Thrombospondin-2 (Thbs2), partial, Unconjugated
Artikelnummer: BIM-RPC24988
Hersteller Artikelnummer: RPC24988
Alternativnummer: BIM-RPC24988-20UG, BIM-RPC24988-100UG, BIM-RPC24988-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Thbs2, Tsp2, Thrombospondin-2
Recombinant Mouse Thrombospondin-2 (Thbs2), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Thbs2. Target Synonyms: Thbs2, Tsp2, Thro
Molekulargewicht: 26.1kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA
Target-Kategorie: Thbs2