Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Active Protein, Unconjugated

Produktübersicht

• Artikelname: Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Active Protein, Unconjugated
• Artikelnummer: BIM-RPC24995
• Hersteller Artikelnummer: RPC24995
• Alternativnummer: BIM-RPC24995-20UG, BIM-RPC24995-100UG, BIM-RPC24995-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated

Produktbeschreibung

Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Active Protein is a purified Active Coronavirus Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: T

Produkteigenschaften

• Molekulargewicht: 44.8kDa
• Tag: N-Terminal 6Xhis-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >85% as determined by SDS-PAGE
• Sequenz: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFND
• Target-Kategorie: TMPRSS2