Recombinant Human Thyroid peroxidase (TPO), partial, Unconjugated

Produktübersicht

• Artikelname: Recombinant Human Thyroid peroxidase (TPO), partial, Unconjugated
• Artikelnummer: BIM-RPC24999
• Hersteller Artikelnummer: RPC24999
• Alternativnummer: BIM-RPC24999-20UG, BIM-RPC24999-100UG, BIM-RPC24999-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Konjugation: Unconjugated
• Alternative Synonym: MSA, PERT_HUMAN, TDH2A, Thyroid microsomal antigen, Thyroid peroxidase, Thyroperoxidase, TPO, TPX

Produktbeschreibung

Recombinant Human Thyroid peroxidase (TPO), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: TPO. Target Synonyms: MSA, PERT_HUMAN, TD

Produkteigenschaften

• Molekulargewicht: 17.9kDa
• Tag: N-Terminal 6Xhis-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: FFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALSEDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNR
• Target-Kategorie: TPO