Recombinant Mouse Uromodulin (Umod), partial, Unconjugated

Artikelnummer: BIM-RPC25017
Artikelname: Recombinant Mouse Uromodulin (Umod), partial, Unconjugated
Artikelnummer: BIM-RPC25017
Hersteller Artikelnummer: RPC25017
Alternativnummer: BIM-RPC25017-20UG, BIM-RPC25017-100UG, BIM-RPC25017-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Tamm-Horsfall urinary glycoproteinTHPCleaved into the following chain:Uromodulin, secreted form
Recombinant Mouse Uromodulin (Umod), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Umod. Target Synonyms: Tamm-Horsfall urinary gly
Molekulargewicht: 64.2kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: NSTEARRCSECHNNATCTVDGVVTTCSCQTGFTGDGLVCEDMDECATPWTHNCSNSSCVNTPGSFKCSCQDGFRLTPELSCTDVDECSEQGLSNCHALATCVNTEGDYLCVCPEGFTGDGWYCECSPGSCEPGLDCLPQGPDGKLVCQDPCNTYETLTEYWRSTEYGVGYSCDAGLHGWYRFTGQGGVRMAETCVPVLRCNTAAPMWLNGSHPSSSEGIVSRTACAHWSDQCCRWSTEIQVKACPGGFYIYNLT
Target-Kategorie: Umod