Recombinant Human Transcriptional coactivator YAP1 (YAP1), Unconjugated

Artikelnummer: BIM-RPC25030
Artikelname: Recombinant Human Transcriptional coactivator YAP1 (YAP1), Unconjugated
Artikelnummer: BIM-RPC25030
Hersteller Artikelnummer: RPC25030
Alternativnummer: BIM-RPC25030-20UG, BIM-RPC25030-100UG, BIM-RPC25030-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Protein yorkie homologYes-associated protein YAP65 homolog
Recombinant Human Transcriptional coactivator YAP1 (YAP1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: YAP1. Target Synonyms: Protein york
Molekulargewicht: 56.5kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNK
Target-Kategorie: YAP1