Recombinant Mouse Y-box-binding protein 1 (Ybx1), Unconjugated

Artikelnummer: BIM-RPC25031
Artikelname: Recombinant Mouse Y-box-binding protein 1 (Ybx1), Unconjugated
Artikelnummer: BIM-RPC25031
Hersteller Artikelnummer: RPC25031
Alternativnummer: BIM-RPC25031-20UG, BIM-RPC25031-100UG, BIM-RPC25031-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: CCAAT-binding transcription factor I subunit A, CBF-ADNA-binding protein B, DBPBEnhancer factor I subunit A, EFI-AY-box transcription factorY-box-binding protein 1, YB-1
Recombinant Mouse Y-box-binding protein 1 (Ybx1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Ybx1. Target Synonyms: CCAAT-binding transcr
Molekulargewicht: 37.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: SSEAETQQPPAAPAAALSAADTKPGSTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYARRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPRE
Target-Kategorie: Ybx1