Recombinant Human cytomegalovirus Enhanced green fluorescent protein (egfp), Unconjugated

Artikelnummer: BIM-RPC25034
Artikelname: Recombinant Human cytomegalovirus Enhanced green fluorescent protein (egfp), Unconjugated
Artikelnummer: BIM-RPC25034
Hersteller Artikelnummer: RPC25034
Alternativnummer: BIM-RPC25034-20UG, BIM-RPC25034-100UG, BIM-RPC25034-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Recombinant Human cytomegalovirus Enhanced green fluorescent protein (egfp) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human cytomegalovirus (HHV-5) (Human herpesvirus 5).
Molekulargewicht: 30.9kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK
Target-Kategorie: egfp