Recombinant Mycobacterium tuberculosis Antitoxin MT2731 (MT2731), Unconjugated

Artikelnummer: BIM-RPC25036
Artikelname: Recombinant Mycobacterium tuberculosis Antitoxin MT2731 (MT2731), Unconjugated
Artikelnummer: BIM-RPC25036
Hersteller Artikelnummer: RPC25036
Alternativnummer: BIM-RPC25036-20UG, BIM-RPC25036-100UG, BIM-RPC25036-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: MT2731, Antitoxin MT2731
Recombinant Mycobacterium tuberculosis Antitoxin MT2731 (MT2731) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh). Target
Molekulargewicht: 9.7kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDPP
Target-Kategorie: MT2731