Recombinant Trichoderma reesei Hydrophobin-2 (hfb2), Unconjugated

Artikelnummer: BIM-RPC25048
Artikelname: Recombinant Trichoderma reesei Hydrophobin-2 (hfb2), Unconjugated
Artikelnummer: BIM-RPC25048
Hersteller Artikelnummer: RPC25048
Alternativnummer: BIM-RPC25048-20UG, BIM-RPC25048-100UG, BIM-RPC25048-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Fungi
Konjugation: Unconjugated
Alternative Synonym: Hydrophobin II
Recombinant Trichoderma reesei Hydrophobin-2 (hfb2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Hypocrea jecorina (Trichoderma reesei). Target Name: hfb2. Target Synonyms:
Molekulargewicht: 23.2kDa
Tag: N-Terminal 6Xhis-Sumostar-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF
Target-Kategorie: hfb2