Recombinant Escherichia coli Periplasmic serine endoprotease DegP (degP), Unconjugated

Produktübersicht

• Artikelname: Recombinant Escherichia coli Periplasmic serine endoprotease DegP (degP), Unconjugated
• Artikelnummer: BIM-RPC25077
• Hersteller Artikelnummer: RPC25077
• Alternativnummer: BIM-RPC25077-20UG, BIM-RPC25077-100UG, BIM-RPC25077-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: E. coli
• Konjugation: Unconjugated
• Alternative Synonym: Heat shock protein DegPProtease Do

Produktbeschreibung

Recombinant Escherichia coli Periplasmic serine endoprotease DegP (degP) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Escherichia coli (strain K12). Target Name: degP. Targe

Produkteigenschaften

• Molekulargewicht: 48.8kDa
• Tag: N-Terminal 6Xhis-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQM
• Target-Kategorie: degP