Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1), partial, Unconjugated

Artikelnummer: BIM-RPC25086
Artikelname: Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1), partial, Unconjugated
Artikelnummer: BIM-RPC25086
Hersteller Artikelnummer: RPC25086
Alternativnummer: BIM-RPC25086-20UG, BIM-RPC25086-100UG, BIM-RPC25086-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: Protein p63
Recombinant Epstein-Barr virus Latent membrane protein 1 (LMP1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Epstein-Barr virus (strain Raji) (HHV-4) (Human herpesv
Molekulargewicht: 23kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: YYHGQRHSDEHHHDDSLPHPQQATDDSSNQSDSNSNEGRHLLLVSGAGDGPPLCSQNLGAPGGGPNNGPQDPDNTDDNGPQDPDNTDDNGPHDPLPQDPDNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPQLTEEVENKGGDQGPPLMTDGGGGHSHDSGHDGIDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD
Target-Kategorie: LMP1