Recombinant Saccharomyces cerevisiae Glycerol 2-dehydrogenase (GCY1), Unconjugated

Artikelnummer: BIM-RPC25104
Artikelname: Recombinant Saccharomyces cerevisiae Glycerol 2-dehydrogenase (GCY1), Unconjugated
Artikelnummer: BIM-RPC25104
Hersteller Artikelnummer: RPC25104
Alternativnummer: BIM-RPC25104-20UG, BIM-RPC25104-100UG, BIM-RPC25104-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Yeast
Konjugation: Unconjugated
Alternative Synonym: Galactose-inducible crystallin-like protein 1
Recombinant Saccharomyces cerevisiae Glycerol 2-dehydrogenase (GCY1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bake
Molekulargewicht: 37.1kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKNNVQPGHVVISWH
Target-Kategorie: GCY1