Recombinant Vicia faba Legumin type B (LEB6), partial, Unconjugated

Produktübersicht

• Artikelname: Recombinant Vicia faba Legumin type B (LEB6), partial, Unconjugated
• Artikelnummer: BIM-RPC25121
• Hersteller Artikelnummer: RPC25121
• Alternativnummer: BIM-RPC25121-20UG, BIM-RPC25121-100UG, BIM-RPC25121-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Plant
• Konjugation: Unconjugated
• Alternative Synonym: Legumin type B acidic chain

Produktbeschreibung

Recombinant Vicia faba Legumin type B (LEB6), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Vicia faba (Broad bean) (Faba vulgaris). Target Name: LEB6. Target Synonym

Produkteigenschaften

• Molekulargewicht: 19kDa
• Tag: N-Terminal 6Xhis-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: GIPYWTYNNGDEPLVAISLLDTSNIANQLDSTPRVFYLGGNPEVEFPETQEEQQERHQQKHSLPVGRRGGQHQQEEDGNSVLSGFSSEFLAQTFNTEEDTAKRLRSPRDKRNQIVRVEGGLRIINPEGQQEEEEEEEEEKQRSEQGRN
• Target-Kategorie: LEB6