Recombinant Glycine max 2S seed storage albumin protein, Unconjugated

Artikelnummer: BIM-RPC25129
Artikelname: Recombinant Glycine max 2S seed storage albumin protein, Unconjugated
Artikelnummer: BIM-RPC25129
Hersteller Artikelnummer: RPC25129
Alternativnummer: BIM-RPC25129-20UG, BIM-RPC25129-100UG, BIM-RPC25129-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Plant
Konjugation: Unconjugated
Alternative Synonym: 2S albumin, GM2S-1, Napin-type 2S albumin 3, Cleaved into: 2S albumin small chain, Aspartic acid-rich peptide, Lunasin, 2S albumin large chain, 8 kDa methionine-rich protein, 8 kDa MRP
Recombinant Glycine max 2S seed storage albumin protein is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Glycine max (Soybean) (Glycine hispida). Target Name: Glycine max 2S see
Molekulargewicht: 18.2kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDDNHILRTMRGRINYIRRNEGKDEDEEEEGHMQKCCTEMSELRSPKCQCKALQKIMENQSEELEEKQKKKMEKELINLATMCRFGPMIQCDLSSDD
Target-Kategorie: Glycine max 2S seed storage albumin protein