Recombinant Mouse Mast cell protease 4 (Mcpt4), Unconjugated

Artikelnummer: BIM-RPC25130
Artikelname: Recombinant Mouse Mast cell protease 4 (Mcpt4), Unconjugated
Artikelnummer: BIM-RPC25130
Hersteller Artikelnummer: RPC25130
Alternativnummer: BIM-RPC25130-20UG, BIM-RPC25130-100UG, BIM-RPC25130-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: mMCP-4MSMCPMyonaseSerosal mast cell protease
Recombinant Mouse Mast cell protease 4 (Mcpt4) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Mcpt4. Target Synonyms: mMCP-4MSMCPMyonaseSero
Molekulargewicht: 27.1kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE
Target-Kategorie: Mcpt4