Recombinant Ornithodoros moubata Tick anticoagulant peptide, Unconjugated

Produktübersicht

• Artikelname: Recombinant Ornithodoros moubata Tick anticoagulant peptide, Unconjugated
• Artikelnummer: BIM-RPC25131
• Hersteller Artikelnummer: RPC25131
• Alternativnummer: BIM-RPC25131-20UG, BIM-RPC25131-100UG, BIM-RPC25131-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Konjugation: Unconjugated
• Alternative Synonym: Tick anticoagulant peptide, TAP

Produktbeschreibung

Recombinant Ornithodoros moubata Tick anticoagulant peptide is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Ornithodoros moubata (Soft tick) (Argasid tick). Target Name: Ornith

Produkteigenschaften

• Molekulargewicht: 9kDa
• Tag: N-Terminal 6Xhis-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: YNRLCIKPRDWIDECDSNEGGERAYFRNGKGGCDSFWICPEDHTGADYYSSYRDCFNACI
• Target-Kategorie: Ornithodoros moubata Tick anticoagulant peptide