Recombinant Ustilago maydis P6 virus KP6 killer toxin, Unconjugated

Produktübersicht

• Artikelname: Recombinant Ustilago maydis P6 virus KP6 killer toxin, Unconjugated
• Artikelnummer: BIM-RPC25132
• Hersteller Artikelnummer: RPC25132
• Alternativnummer: BIM-RPC25132-20UG, BIM-RPC25132-100UG, BIM-RPC25132-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Virus
• Konjugation: Unconjugated
• Alternative Synonym: KP6 killer toxin, Killer protein 6, Cleaved into: KP6 killer toxin subunit alpha, VP10, KP6 killer toxin subunit beta, VP12.5

Produktbeschreibung

Recombinant Ustilago maydis P6 virus KP6 killer toxin is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Ustilago maydis P6 virus (UmV6) (UmV-P6). Target Name: Ustilago maydis P6

Produkteigenschaften

• Molekulargewicht: 10.6kDa
• Tag: N-Terminal 6Xhis-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLS
• Target-Kategorie: Ustilago maydis P6 virus KP6 killer toxin