Recombinant Salmonella typhi 3-dehydroquinate dehydratase (aroD), Unconjugated

Artikelnummer: BIM-RPC25134
Artikelname: Recombinant Salmonella typhi 3-dehydroquinate dehydratase (aroD), Unconjugated
Artikelnummer: BIM-RPC25134
Hersteller Artikelnummer: RPC25134
Alternativnummer: BIM-RPC25134-20UG, BIM-RPC25134-100UG, BIM-RPC25134-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Type I DHQase
Recombinant Salmonella typhi 3-dehydroquinate dehydratase (aroD) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Salmonella typhi. Target Name: aroD. Target Synonyms: Type I DH
Molekulargewicht: 29.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: MKTVTVKNLIIGEGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDFHQTPSAEEMVLRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILHNA
Target-Kategorie: aroD