Recombinant Human rhinovirus 1A Genome polyprotein, Unconjugated

Artikelnummer: BIM-RPC25135
Artikelname: Recombinant Human rhinovirus 1A Genome polyprotein, Unconjugated
Artikelnummer: BIM-RPC25135
Hersteller Artikelnummer: RPC25135
Alternativnummer: BIM-RPC25135-20UG, BIM-RPC25135-100UG, BIM-RPC25135-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: Genome polyprotein, Cleaved into: P1, Capsid protein VP0, VP4-VP2, Capsid protein VP4, P1A, Virion protein 4, Capsid protein VP2, P1B, Virion protein 2, Capsid protein VP3, P1C, Virion protein 3, Capsid protein VP1, P1D, Virion protein 1, P2, Protease 2A
Recombinant Human rhinovirus 1A Genome polyprotein is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human rhinovirus 1A (HRV-1A). Target Name: Human rhinovirus 1A Genome polypro
Molekulargewicht: 34.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: NPVENYIDEVLNEVLVVPNIKESHHTTSNSAPLLDAAETGHTSNVQPEDAIETRYVITSQTRDEMSIESFLGRSGCVHISRIKVDYTDYNGQDINFTKWKITLQEMAQIRRKFELFTYVRFDSEITLVPCIAGRGDDIGHIVMQYMYVPPGAPIPSKRNDFSWQSGTNMSIFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDNTSSKYGSVVTNDMGTICSRIVTEKQKHSVVITTHIYHKAKHTKAWCPRPP
Target-Kategorie: Human rhinovirus 1A Genome polyprotein