Recombinant Salmonella typhimurium Protein PrgJ (prgJ), Unconjugated

Artikelnummer: BIM-RPC25145
Artikelname: Recombinant Salmonella typhimurium Protein PrgJ (prgJ), Unconjugated
Artikelnummer: BIM-RPC25145
Hersteller Artikelnummer: RPC25145
Alternativnummer: BIM-RPC25145-20UG, BIM-RPC25145-100UG, BIM-RPC25145-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: prgJ, STM2872Protein PrgJ
Recombinant Salmonella typhimurium Protein PrgJ (prgJ) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720). Target Name
Molekulargewicht: 14.4kDa
Tag: N-Terminal 6Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS
Target-Kategorie: prgJ