Recombinant Malus domestica Major allergen Mal d 1 (MALD1), Unconjugated

Artikelnummer: BIM-RPC25148
Artikelname: Recombinant Malus domestica Major allergen Mal d 1 (MALD1), Unconjugated
Artikelnummer: BIM-RPC25148
Hersteller Artikelnummer: RPC25148
Alternativnummer: BIM-RPC25148-20UG, BIM-RPC25148-100UG, BIM-RPC25148-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Alternative Synonym: Allergen Mal d IAllergen: Mal d 1
Recombinant Malus domestica Major allergen Mal d 1 (MALD1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Malus domestica (Apple) (Pyrus malus). Target Name: MALD1. Target Syn
Molekulargewicht: 19.5kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN
Target-Kategorie: MALD1