Recombinant Saccharomyces cerevisiae GTP-binding nuclear protein GSP1/CNR1 (GSP1), Unconjugated

Produktübersicht

• Artikelname: Recombinant Saccharomyces cerevisiae GTP-binding nuclear protein GSP1/CNR1 (GSP1), Unconjugated
• Artikelnummer: BIM-RPC25157
• Hersteller Artikelnummer: RPC25157
• Alternativnummer: BIM-RPC25157-20UG, BIM-RPC25157-100UG, BIM-RPC25157-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Yeast
• Konjugation: Unconjugated
• Alternative Synonym: Chromosome stability protein 17GTPase Ran homologGenetic suppressor of PRP20-1

Produktbeschreibung

Recombinant Saccharomyces cerevisiae GTP-binding nuclear protein GSP1/CNR1 (GSP1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Saccharomyces cerevisiae (strain ATCC 204508 /

Produkteigenschaften

• Molekulargewicht: 26.7kDa
• Tag: N-Terminal 6Xhis-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: SAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL
• Target-Kategorie: GSP1