Recombinant Arabidopsis thaliana Nucleoside diphosphate kinase 1 (NDK1), Unconjugated

Artikelnummer: BIM-RPC25173
Artikelname: Recombinant Arabidopsis thaliana Nucleoside diphosphate kinase 1 (NDK1), Unconjugated
Artikelnummer: BIM-RPC25173
Hersteller Artikelnummer: RPC25173
Alternativnummer: BIM-RPC25173-20UG, BIM-RPC25173-100UG, BIM-RPC25173-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: A. thaliana
Konjugation: Unconjugated
Alternative Synonym: Nucleoside diphosphate kinase INDK INDP kinase INDPK I
Recombinant Arabidopsis thaliana Nucleoside diphosphate kinase 1 (NDK1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress). Target Name: NDK
Molekulargewicht: 20.5kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: MEQTFIMIKPDGVQRGLIGEVICRFEKKGFTLKGLKLISVERSFAEKHYEDLSSKSFFSGLVDYIVSGPVVAMIWEGKNVVLTGRKIIGATNPAASEPGTIRGDFAIDIGRNVIHGSDSVESARKEIALWFPDGPVNWQSSVHPWVYET
Target-Kategorie: NDK1