Recombinant Calloselasma rhodostoma Thrombin-like enzyme ancrod, Unconjugated

Artikelnummer: BIM-RPC25176
Artikelname: Recombinant Calloselasma rhodostoma Thrombin-like enzyme ancrod, Unconjugated
Artikelnummer: BIM-RPC25176
Hersteller Artikelnummer: RPC25176
Alternativnummer: BIM-RPC25176-20UG, BIM-RPC25176-100UG, BIM-RPC25176-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Reptile
Konjugation: Unconjugated
Alternative Synonym: Thrombin-like enzyme ancrod, SVTLE, EC 3.4.21.74, Fibrinogen-clotting enzyme, Snake venom serine protease, SVSP, Venombin A
Recombinant Calloselasma rhodostoma Thrombin-like enzyme ancrod is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodost
Molekulargewicht: 28.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: VIGGDECNINEHRFLVAVYEGTNWTFICGGVLIHPEWVITAEHCARRRMNLVFGMHRKSEKFDDEQERYPKKRYFIRCNKTRTSWDEDIMLIRLNKPVNNSEHIAPLSLPSNPPIVGSDCRVMGWGSINRRIDVLSDEPRCANINLHNFTMCHGLFRKMPKKGRVLCAGDLRGRRDSCNSDSGGPLICNEELHGIVARGPNPCAQPNKPALYTSIYDYRDWVNNVIAGNATCSP
Target-Kategorie: Calloselasma rhodostoma Thrombin-like enzyme ancrod