Recombinant Yersinia pestis F1 capsule antigen (caf1), Unconjugated

Artikelnummer: BIM-RPC25177
Artikelname: Recombinant Yersinia pestis F1 capsule antigen (caf1), Unconjugated
Artikelnummer: BIM-RPC25177
Hersteller Artikelnummer: RPC25177
Alternativnummer: BIM-RPC25177-20UG, BIM-RPC25177-100UG, BIM-RPC25177-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: caf1, YPMT1.84, Y1100, YP_pMT082F1 capsule antigen
Recombinant Yersinia pestis F1 capsule antigen (caf1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Yersinia pestis. Target Name: caf1. Target Synonyms: caf1, YPMT1.84, Y1100
Molekulargewicht: 17.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: ADLTASTTATATLVEPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
Target-Kategorie: caf1