Recombinant Hirudo nipponia Guamerin, Unconjugated

Artikelnummer: BIM-RPC25189
Artikelname: Recombinant Hirudo nipponia Guamerin, Unconjugated
Artikelnummer: BIM-RPC25189
Hersteller Artikelnummer: RPC25189
Alternativnummer: BIM-RPC25189-20UG, BIM-RPC25189-100UG, BIM-RPC25189-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Alternative Synonym: Guamerin
Recombinant Hirudo nipponia Guamerin is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Hirudo nipponia (Korean blood-sucking leech). Target Name: Hirudo nipponia Guamerin. Target
Molekulargewicht: 8.1kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: VDENAEDTHGLCGEKTCSPAQVCLNNECACTAIRCMIFCPNGFKVDENGCEYPCTCA
Target-Kategorie: Hirudo nipponia Guamerin