Recombinant Human herpesvirus 6A DNA polymerase processivity factor (U27), Unconjugated

Artikelnummer: BIM-RPC25200
Artikelname: Recombinant Human herpesvirus 6A DNA polymerase processivity factor (U27), Unconjugated
Artikelnummer: BIM-RPC25200
Hersteller Artikelnummer: RPC25200
Alternativnummer: BIM-RPC25200-20UG, BIM-RPC25200-100UG, BIM-RPC25200-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: Phosphoprotein P41, PP41, Polymerase accessory protein, PAP
Recombinant Human herpesvirus 6A DNA polymerase processivity factor (U27) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human herpesvirus 6A (strain Uganda-1102) (HHV-6 varia
Molekulargewicht: 46.8kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: MCWSFHLFFKAHKARVGARTSFLTEMERGSRDHHRDHRDHREHRETREPPTLAFHMKSWKTINKSLKAFAKLLKENTTVTFTPQPSIIIQSAKNHLVQKLTIQAECLFLSDTDRFLTKTINNHIPLFESFMNIISNPEVTKMYIQHDSDLYTRVLVTASDTCTQASVPCVHGQEVVRDTGRSPLRIDLDHSTVSDVLKWLSPVTKTKRSGKSDALMAHIIVQVNPPTIKFVTEMNELEFSNSNKVIFYDVKNMR
Target-Kategorie: U27