Recombinant Mouse Insulin-1 (Ins1), Unconjugated

Artikelnummer: BIM-RPC25212
Artikelname: Recombinant Mouse Insulin-1 (Ins1), Unconjugated
Artikelnummer: BIM-RPC25212
Hersteller Artikelnummer: RPC25212
Alternativnummer: BIM-RPC25212-20UG, BIM-RPC25212-100UG, BIM-RPC25212-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: Ins1, Ins-1, Insulin-1 [Cleaved into: Insulin-1 B chain, Insulin-1 A chain]
Recombinant Mouse Insulin-1 (Ins1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Ins1. Target Synonyms: Ins1, Ins-1, Insulin-1 [Cleaved int
Molekulargewicht: 13kDa
Tag: N-Terminal 6Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
Target-Kategorie: Ins1