Recombinant Centruroides noxius Beta-mammal toxin Cn2, Unconjugated

Artikelnummer: BIM-RPC25213
Artikelname: Recombinant Centruroides noxius Beta-mammal toxin Cn2, Unconjugated
Artikelnummer: BIM-RPC25213
Hersteller Artikelnummer: RPC25213
Alternativnummer: BIM-RPC25213-20UG, BIM-RPC25213-100UG, BIM-RPC25213-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Alternative Synonym: Toxin II.9.2.2
Recombinant Centruroides noxius Beta-mammal toxin Cn2 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Centruroides noxius (Mexican scorpion). Target Name: Centruroides noxius B
Molekulargewicht: 9.6kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS
Target-Kategorie: Centruroides noxius Beta-mammal toxin Cn2