Recombinant Anemonia sulcata Delta-actitoxin-Avd1c, Unconjugated

Artikelnummer: BIM-RPC25214
Artikelname: Recombinant Anemonia sulcata Delta-actitoxin-Avd1c, Unconjugated
Artikelnummer: BIM-RPC25214
Hersteller Artikelnummer: RPC25214
Alternativnummer: BIM-RPC25214-20UG, BIM-RPC25214-100UG, BIM-RPC25214-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Alternative Synonym: ATX-II
Recombinant Anemonia sulcata Delta-actitoxin-Avd1c is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Anemonia sulcata (Mediterranean snakelocks sea anemone). Target Name: Anemoni
Molekulargewicht: 6.9kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: GVPCLCDSDGPSVRGNTLSGIIWLAGCPSGWHNCKKHGPTIGWCCKQ
Target-Kategorie: Anemonia sulcata Delta-actitoxin-Avd1c