Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA), Unconjugated

Produktübersicht

• Artikelname: Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA), Unconjugated
• Artikelnummer: BIM-RPC25226
• Hersteller Artikelnummer: RPC25226
• Alternativnummer: BIM-RPC25226-20UG, BIM-RPC25226-100UG, BIM-RPC25226-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Bacteria
• Konjugation: Unconjugated
• Alternative Synonym: Islet-activating protein S1, IAP S1NAD-dependent ADP-ribosyltransferase (EC:2.4.2.-)

Produktbeschreibung

Recombinant Bordetella pertussis Pertussis toxin subunit 1 (ptxA) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13

Produkteigenschaften

• Molekulargewicht: 28.2kDa
• Tag: N-Terminal 6Xhis-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: DDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF
• Target-Kategorie: ptxA