Recombinant Human papillomavirus type 18 Minor capsid protein L2 (L2), Unconjugated

Produktübersicht

• Artikelname: Recombinant Human papillomavirus type 18 Minor capsid protein L2 (L2), Unconjugated
• Artikelnummer: BIM-RPC25231
• Hersteller Artikelnummer: RPC25231
• Alternativnummer: BIM-RPC25231-20UG, BIM-RPC25231-100UG, BIM-RPC25231-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Virus
• Konjugation: Unconjugated
• Alternative Synonym: L2, Minor capsid protein L2

Produktbeschreibung

Recombinant Human papillomavirus type 18 Minor capsid protein L2 (L2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human papillomavirus type 18. Target Name: L2. Target Syno

Produkteigenschaften

• Molekulargewicht: 51.6kDa
• Tag: N-Terminal 6Xhis-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: MVSHRAARRKRASVTDLYKTCKQSGTCPPDVVPKVEGTTLADKILQWSSLGIFLGGLGIGTGSGTGGRTGYIPLGGRSNTVVDVGPTRPPVVIEPVGPTDPSIVTLIEDSSVVTSGAPRPTFTGTSGFDITSAGTTTPAVLDITPSSTSVSISTTNFTNPAFSDPSIIEVPQTGEVAGNVFVGTPTSGTHGYEEIPLQTFASSGTGEEPISSTPLPTVRRVAGPRLYSRAYQQVSVANPEFLTRPSSLITYDNP
• Target-Kategorie: L2