Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2), Unconjugated

Produktübersicht

• Artikelname: Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2), Unconjugated
• Artikelnummer: BIM-RPC25236
• Hersteller Artikelnummer: RPC25236
• Alternativnummer: BIM-RPC25236-20UG, BIM-RPC25236-100UG, BIM-RPC25236-1MG
• Hersteller: Biomatik Corporation
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Bacteria
• Konjugation: Unconjugated
• Alternative Synonym: Verocytotoxin 2 subunit B, Verotoxin 2 subunit B

Produktbeschreibung

Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Enterobacteria phage 933W (Bacteriophage 933W). Targe

Produkteigenschaften

• Molekulargewicht: 9.8kDa
• Tag: N-Terminal 6Xhis-Tagged
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reinheit: >90% as determined by SDS-PAGE
• Sequenz: ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
• Target-Kategorie: stxB2