Recombinant Staphylococcus aureus Phospholipase C (hlb), Unconjugated

Artikelnummer: BIM-RPC25237
Artikelname: Recombinant Staphylococcus aureus Phospholipase C (hlb), Unconjugated
Artikelnummer: BIM-RPC25237
Hersteller Artikelnummer: RPC25237
Alternativnummer: BIM-RPC25237-20UG, BIM-RPC25237-100UG, BIM-RPC25237-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Beta-hemolysinBeta-toxinSphingomyelinaseplc
Recombinant Staphylococcus aureus Phospholipase C (hlb) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain MRSA252). Target Name: hlb. Target Synonym
Molekulargewicht: 35.7kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% as determined by SDS-PAGE
Sequenz: ESKKDDTDLKLVSHNVYMLSTVLYPNWGQYKRADLIGQSSYIKNNDVVIFNEAFDNGASDKLLSNVKKEYPYQTPVLGRSQSGWDKTEGSYSSTVAEDGGVAIVSKYPIKEKIQHVFKSGCGFDNDSNKGFVYTKIEKNGKNVHVIGTHTQSEDSRCGAGHDRKIRAEQMKEISDFVKKKNIPKDETVYIGGDLNVNKGTPEFKDMLKNLNVNDVLYAGHNSTWDPQSNSIAKYNYPNGKPEHLDYIFTDKDHK
Target-Kategorie: hlb