Recombinant Staphylococcus aureus Enterotoxin type G (entG), Unconjugated

Artikelnummer: BIM-RPC25241
Artikelname: Recombinant Staphylococcus aureus Enterotoxin type G (entG), Unconjugated
Artikelnummer: BIM-RPC25241
Hersteller Artikelnummer: RPC25241
Alternativnummer: BIM-RPC25241-20UG, BIM-RPC25241-100UG, BIM-RPC25241-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: SEG
Recombinant Staphylococcus aureus Enterotoxin type G (entG) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Staphylococcus aureus (strain N315). Target Name: entG. Target Synon
Molekulargewicht: 29kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: QPDPKLDELNKVSDYKNNKGTMGNVMNLYTSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKDKKVDIFGVPYFYTCIIPKSEPDINQNFGGCCMYGGLTFNSSENERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH
Target-Kategorie: entG