Recombinant Staphylococcus aureus Enterotoxin type B (entB), Unconjugated

Artikelnummer: BIM-RPC25253
Artikelname: Recombinant Staphylococcus aureus Enterotoxin type B (entB), Unconjugated
Artikelnummer: BIM-RPC25253
Hersteller Artikelnummer: RPC25253
Alternativnummer: BIM-RPC25253-20UG, BIM-RPC25253-100UG, BIM-RPC25253-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: SEB
Recombinant Staphylococcus aureus Enterotoxin type B (entB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Staphylococcus aureus. Target Name: entB. Target Synonyms: SEB. Acce
Molekulargewicht: 30.4kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% as determined by SDS-PAGE
Sequenz: ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK
Target-Kategorie: entB