Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Unconjugated

Artikelnummer: BIM-RPC27164
Artikelname: Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Unconjugated
Artikelnummer: BIM-RPC27164
Hersteller Artikelnummer: RPC27164
Alternativnummer: BIM-RPC27164-20UG, BIM-RPC27164-100UG, BIM-RPC27164-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Serine protease 10, PRSS10
Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial is a purified Recombinant Protein, Coronavirus Protein. Purity: >85% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target
Molekulargewicht: 47.8kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% as determined by SDS-PAGE
Sequenz: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFND
Target-Kategorie: TMPRSS2