Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Biotinylated, Unconjugated

Artikelnummer: BIM-RPC27187
Artikelname: Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Biotinylated, Unconjugated
Artikelnummer: BIM-RPC27187
Hersteller Artikelnummer: RPC27187
Alternativnummer: BIM-RPC27187-20UG, BIM-RPC27187-100UG, BIM-RPC27187-1MG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Serine protease 10
Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Biotinylated is a purified Recombinant Protein, Coronavirus Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens).
Molekulargewicht: 90.6kDa
Tag: N-Terminal Mbp-Tagged And C-Terminal 6Xhis-Avi-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% as determined by SDS-PAGE
Sequenz: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFND
Target-Kategorie: TMPRSS2