Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Unconjugated

Artikelnummer: BIM-RPC28454
Artikelname: Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial, Unconjugated
Artikelnummer: BIM-RPC28454
Hersteller Artikelnummer: RPC28454
Alternativnummer: BIM-RPC28454-20UG, BIM-RPC28454-100UG
Hersteller: Biomatik Corporation
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: Serine protease 10
Recombinant Human Transmembrane protease serine 2 (TMPRSS2), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: In Vitro E. coli Expression System. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target N
Molekulargewicht: 46.9kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% as determined by SDS-PAGE
Sequenz: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFND
Target-Kategorie: TMPRSS2