Anti-Toll-like Receptor 4 TLR4 Antibody, Goat, Polyclonal

Produktübersicht

• Artikelname: Anti-Toll-like Receptor 4 TLR4 Antibody, Goat, Polyclonal
• Artikelnummer: BOB-A00017
• Hersteller Artikelnummer: A00017
• Alternativnummer: BOB-A00017-200UG
• Hersteller: Boster Bio
• Wirt: Goat
• Kategorie: Antikörper
• Applikation: IF, IHC
• Spezies Reaktivität: Human, Mouse
• Immunogen: Synthetic peptide corresponding to aa 161-192 (L161IQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC192) of the N-terminal domain of human TLR4 (Toll-like receptor 4) .

Produktbeschreibung

Boster Bio Anti-Toll-like Receptor 4 TLR4 Antibody catalog A00017. Tested in IF, IHC applications. This antibody reacts with Human, Mouse.

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.
• UniProt: O00206
• Puffer: Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.
• Reinheit: Epitope-affinity purified IgG.
• Formulierung: Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.

Anwendungsbeschreibung

• Application Verdünnung: Immunocytochemistry (acetone fixed cells, >1:400) Immunohistochemistry (paraffin sections, >1:250) Western Blot (>1:1,000) Suggested dilutions/conditions may not be available for all applications.Optimal conditions must be determined indi