Human recombinant RAGE (Receptor for advanced glycation endproducts) protein, AF

Produktübersicht

• Artikelname: Human recombinant RAGE (Receptor for advanced glycation endproducts) protein, AF
• Artikelnummer: BOB-PROTQ15109-2
• Hersteller Artikelnummer: PROTQ15109-2
• Alternativnummer: BOB-PROTQ15109-2-5UG, BOB-PROTQ15109-2-20UG, BOB-PROTQ15109-2-100UG
• Hersteller: Boster Bio
• Kategorie: Proteine/Peptide
• Applikation: Cell Culture
• Spezies Reaktivität: Human
• Alternative Synonym: advanced glycosylation end-product specific receptor, AGER, SCARJ1

Produktbeschreibung

Receptor for advanced glycation endproducts (RAGE) is a 35 kDa transmembrane receptor of the immunoglobulin super family. The mature RAGE has three main parts, consisting of extracellular, transmembrane, and cytosolic regions. A central mechanism by whic

Produkteigenschaften

• Tag: His Tag (C-term)
• UniProt: Q15109
• Quelle: Escherichia coli
• Reinheit: >98% as determined by SDS-PAGE.
• Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. If you have any concerns or special requirements, please confirm with us.
• Sequenz: MAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDG