Human recombinant Sonic Hedgehog (C24II) protein, AF

Artikelnummer: BOB-PROTQ15465-6
Artikelname: Human recombinant Sonic Hedgehog (C24II) protein, AF
Artikelnummer: BOB-PROTQ15465-6
Hersteller Artikelnummer: PROTQ15465-6
Alternativnummer: BOB-PROTQ15465-6-5UG, BOB-PROTQ15465-6-20UG, BOB-PROTQ15465-6-100UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Human
Alternative Synonym: SHH, TPT, HHG1, HLP3, HPE3, SMMCI, ShhNC, TPTPS, MCOPCB5
Sonic hedgehog protein (SHH) plays a critical role in development of embryonic morphogenesis which mediate the process of organogenesis and central nervous system. The sonic hedgehog signal pathway also plays an important role in cancerous tumors like em
Tag: His-SUMO Tag (N-term)
UniProt: Q15465
Quelle: Escherichia coli
Reinheit: >95% as determined by SDS-PAGE.
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequenz: IIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG