Human recombinant FGF-14 (Fibroblast growth factor-14) protein, AF

Artikelnummer: BOB-PROTQ92915-2
Artikelname: Human recombinant FGF-14 (Fibroblast growth factor-14) protein, AF
Artikelnummer: BOB-PROTQ92915-2
Hersteller Artikelnummer: PROTQ92915-2
Alternativnummer: BOB-PROTQ92915-2-5UG, BOB-PROTQ92915-2-20UG, BOB-PROTQ92915-2-100UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Human
Alternative Synonym: FHF-4, FHF4, SCA27
Fibroblast Growth Factors-14 (FGF-14) is a 27.7 kDa member of the fibroblast Growth Factors with 247 amino acid residues. FGF-14 is mainly expressed from brain, cervix. FGF-14 involved in nervous system development and function. May regulate voltage-gate
Tag: His Tag (N-term)
UniProt: Q92915
Quelle: Escherichia coli
Reinheit: >95% as determined by SDS-PAGE.
Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
Sequenz: AAAIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRIFGLKKRRLRRQDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKT with pol