Human recombinant Galectin-12 protein, AF

Produktübersicht

• Artikelname: Human recombinant Galectin-12 protein, AF
• Artikelnummer: BOB-PROTQ96DT0-2
• Hersteller Artikelnummer: PROTQ96DT0-2
• Alternativnummer: BOB-PROTQ96DT0-2-5UG, BOB-PROTQ96DT0-2-20UG, BOB-PROTQ96DT0-2-100UG
• Hersteller: Boster Bio
• Kategorie: Proteine/Peptide
• Applikation: Cell Culture
• Spezies Reaktivität: Human
• Alternative Synonym: LGALS12, GAL12, GRIP1

Produktbeschreibung

Galectin-12 (Gal-12) is a lectin family member and is one of the tandem repeat-type galectins containing two carbohydrate recognition domains (CRD) connected by a linker region in a single peptide chain. The CRD is responsible for beta-galactoside binding a

Produkteigenschaften

• Tag: His Tag (N-term)
• UniProt: Q96DT0
• Quelle: Escherichia coli
• Reinheit: >98% as determined by SDS-PAGE.
• Formulierung: The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. If you have any concerns or special requirements, please confirm with us.
• Sequenz: SQPSGGRAPGTRIYSWSCPTVMSPGEKLDPIPDSFILQPPVFHPVVPYVTTIFGGLHAGKMVMLQGVVPLDAHRFQVDFQCGCSLCPRPDIAFHFNPRFHTTKPHVICNTLHGGRWQREARWPHLALRRGSSFLILFLFGNEEVKVSVNGQHFLHFRYRLPLSHVDTLGIFGDILVEAVGFLNINPFVEGSREYPAGHPFLLMSPRLEVPCSHALPQGLSPGQVIIVRGLVLQEPKHFTVSLRDQAAHAPVTLR