Recombinant Human FGF2 Protein

Artikelnummer: BOB-R00121
Artikelname: Recombinant Human FGF2 Protein
Artikelnummer: BOB-R00121
Hersteller Artikelnummer: R00121
Alternativnummer: BOB-R00121-100UG
Hersteller: Boster Bio
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Fibroblast Growth Factor basic (FGF-basic/FGF-2) is a single-chain polypeptide growth factor that plays a significant role in the process of wound healing and is a potent inducer of angiogenesis. Several different forms of the human protein exist ranging
Molekulargewicht: 16.5KD
UniProt: P09038
Puffer: Lyophilized after extensive dialysis against PBS.
Quelle: E. Coli-derived P143-S288
Reinheit: >95%, by SDS-PAGE quantitative densitometry by Coomassie Blue Staining.
Formulierung: Lyophilized
Sequenz: PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS