Heart Fatty Acid Binding Protein Human, Rabbit Polyclonal Antibody

Artikelnummer: BVD-RD181247100
Artikelname: Heart Fatty Acid Binding Protein Human, Rabbit Polyclonal Antibody
Artikelnummer: BVD-RD181247100
Hersteller Artikelnummer: RD181247100
Alternativnummer: BVD-RD181247100-0.1
Hersteller: BioVendor
Wirt: Rabbit
Kategorie: Antikörper
Spezies Reaktivität: Human
Alternative Synonym: FABP3, Fatty acid-binding protein 3, H-FABP, Mammary-derived growth inhibitor, MDGI, Muscle fatty acid-binding protein, M-FABP, FABP11
Polyclonal Antibody
Heart Fatty Acid Binding Protein Human, Rabbit Polyclonal Antibody
Klonalität: Polyclonal
Klon-Bezeichnung: Heart Fatty Acid Binding Protein Human, Rabbit Polyclonal Antibody
Isotyp: IgG
Formulierung: The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. **AZIDE FREE**.
Sequenz: **MKHHHHHHAS**VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Lagerung: The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C.Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at...
Target-Kategorie: Heart Fatty Acid Binding Protein
Kommentar: N
Application Verdünnung: Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.