Regucalcin Human, Rabbit Polyclonal Antibody

Artikelnummer: BVD-RD181257100
Artikelname: Regucalcin Human, Rabbit Polyclonal Antibody
Artikelnummer: BVD-RD181257100
Hersteller Artikelnummer: RD181257100
Alternativnummer: BVD-RD181257100-0.1
Hersteller: BioVendor
Wirt: Rabbit
Kategorie: Antikörper
Spezies Reaktivität: Human
Alternative Synonym: RC, Gluconolactonase, GNL, EC=3.1.1.17, Senescence marker protein 30, SMP-30, RGN
Polyclonal Antibody
Regucalcin Human, Rabbit Polyclonal Antibody
Klonalität: Polyclonal
Klon-Bezeichnung: Regucalcin Human, Rabbit Polyclonal Antibody
Formulierung: The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. **AZIDE FREE**.
Sequenz: **MKHHHHHHAS**MSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKL
Lagerung: The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at...
Target-Kategorie: Regucalcin
Application Verdünnung: Add 0.1 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.