PCSK9 Human, Rabbit Polyclonal Antibody

Artikelnummer: BVD-RD181473100
Artikelname: PCSK9 Human, Rabbit Polyclonal Antibody
Artikelnummer: BVD-RD181473100
Hersteller Artikelnummer: RD181473100
Alternativnummer: BVD-RD181473100-0.1
Hersteller: BioVendor
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA
Spezies Reaktivität: Human
Alternative Synonym: Proprotein convertase subtilisin/kexin type 9, PCSK9
Polyclonal Antibody
PCSK9 Human, Rabbit Polyclonal Antibody
Klonalität: Polyclonal
Klon-Bezeichnung: PCSK9 Human, Rabbit Polyclonal Antibody
Isotyp: IgG
Formulierung: The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2. **AZIDE FREE**.
Sequenz: QEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLV
Lagerung: The lyophilized antibody remains stable and fully active until the expiry date when stored at –20°C.Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at –80°C. Reconstituted antibody can be stored at...
Target-Kategorie: PCSK9
Kommentar: This product is for research use only.
Application Verdünnung: Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.